The world's Longest place name


THE WORLD'S LONGEST PLACE NAME
THE LONGEST LIST OF THE LONGEST STUFF AT THE LONGEST DOMAIN NAME AT LONG LAST

What is the world's longest place name?

A little village in Wales boasts the longest place name at 58 letters:
Llanfairpwllgwyngyllgogerychwyr
ndrobwllllantysiliogogogoch...

...But New Zealand makes the same claim with a hill containing 92 letters:
Tetaumatawhakatangihangakoauaotamateaurehaeaturipuk
apihimaungahoronukupokaiwhenuaakitanarahu...

...But after some further digging we found the winner to be Bangkok. OK, so that's only 7 letters, but the official ceremonial name of Bangkok is Krung Thep Mahanakhon for short meaning 'City of Angels'.

The full name of Bangkok has many variations in spelling but we found what is believed to be the official spelling coming in at 163 letters:
Krungthepmahanakornamornratanakosinmahintarayutthaya
mahadilokphopnopparatrajathaniburiromudomrajaniwesmaha
satharnamornphimarnavatarnsathitsakkattiyavisanukamprasit

The world's Longest place name

The world's Longest place name

Page Sponsored By: MP3 Editor